PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g001260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 443aa    MW: 51253.4 Da    PI: 6.3329
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g001260.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.63.7e-1774125556
                     SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ eq+++Le+ Fe  +++  e++ +LAk lg++ rq+ +WFqNrRa++k
  Csa15g001260.1  74 KRLQLEQVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWK 125
                     457889*********************************************9 PP

2Homeobox53.63.7e-17244295556
                     SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ eq+++Le+ Fe  +++  e++ +LAk lg++ rq+ +WFqNrRa++k
  Csa15g001260.1 244 KRLQLEQVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWK 295
                     457889*********************************************9 PP

3HD-ZIP_I/II122.12.8e-3971161191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     ekk+rl+ eqvk+LE+sFe  +kLeperK +la++Lg+qprq+a+WFqnrRAR+kt+qlE+dy++Lk+++++lk++n++L + +++L +e+
  Csa15g001260.1  71 EKKKRLQLEQVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWKTRQLERDYDSLKKQFESLKSDNDSLLAYNKKLLAEV 161
                     69************************************************************************************99887 PP

4HD-ZIP_I/II1223e-39241332192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     ekk+rl+ eqvk+LE+sFe  +kLeperK +la++Lg+qprq+a+WFqnrRAR+kt+qlE+dy++Lk+++++lk++n++L + +++L +e++
  Csa15g001260.1 241 EKKKRLQLEQVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWKTRQLERDYDSLKKQFESLKSDNDSLLAYNKKLLAEVM 332
                     69*************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.11567127IPR001356Homeobox domain
SMARTSM003894.6E-1670131IPR001356Homeobox domain
SuperFamilySSF466895.56E-1870129IPR009057Homeodomain-like
CDDcd000864.21E-1472128No hitNo description
PfamPF000462.3E-1473125IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.8E-1875135IPR009057Homeodomain-like
PRINTSPR000316.4E-598107IPR000047Helix-turn-helix motif
PROSITE patternPS000270102125IPR017970Homeobox, conserved site
PRINTSPR000316.4E-5107123IPR000047Helix-turn-helix motif
PfamPF021832.1E-11128161IPR003106Leucine zipper, homeobox-associated
PROSITE profilePS5007116.115237297IPR001356Homeobox domain
SuperFamilySSF466895.56E-18240299IPR009057Homeodomain-like
SMARTSM003894.6E-16240301IPR001356Homeobox domain
CDDcd000864.21E-14242298No hitNo description
PfamPF000462.3E-14243295IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.8E-18245305IPR009057Homeodomain-like
PROSITE patternPS000270272295IPR017970Homeobox, conserved site
PfamPF021839.2E-14298337IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MAFPQHGFMF QQLHEDTSQD QLPSCPPHLF SGGGNYMMNR SMSLMNVQED HNQTLDEENL  60
SDDGAHTMLG EKKKRLQLEQ VKALEKSFEL GNKLEPERKI QLAKALGMQP RQIAIWFQNR  120
RARWKTRQLE RDYDSLKKQF ESLKSDNDSL LAYNKKLLAE VYADAGLRLE MAFPQHGFMF  180
QQLHEDTSQD QLPSCPPHLF SGGGNYMMNR SMSLMNVQED HNQTLDEENL SDDGAHTMLG  240
EKKKRLQLEQ VKALEKSFEL GNKLEPERKI QLAKALGMQP RQIAIWFQNR RARWKTRQLE  300
RDYDSLKKQF ESLKSDNDSL LAYNKKLLAE VMALKNKECN ESNIIKREAE ASWSNNGSTE  360
NSSDINLEMP REITTTHVNT IKDLFPSSIR SSAHRDNDDH HQNHEMVQEE SLCNMFNGID  420
ETTSAGYWAW SDPNHNHPHQ FN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00322DAPTransfer from AT3G01220Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2288900.0AK228890.1 Arabidopsis thaliana mRNA for putative homeobox-leucine zipper protein, complete cds, clone: RAFL16-20-K05.
GenBankAY0876310.0AY087631.1 Arabidopsis thaliana clone 3722 mRNA, complete sequence.
GenBankBT0292210.0BT029221.1 Arabidopsis thaliana At3g01220 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010463554.10.0PREDICTED: homeobox-leucine zipper protein ATHB-20 isoform X1
RefseqXP_010463555.10.0PREDICTED: homeobox-leucine zipper protein ATHB-20 isoform X2
SwissprotQ8LAT00.0ATB20_ARATH; Homeobox-leucine zipper protein ATHB-20
TrEMBLD7LAH80.0D7LAH8_ARALL; ATHB20
STRINGscaffold_300109.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30952666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01220.10.0homeobox protein 20